PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G238900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 510aa    MW: 57808.6 Da    PI: 7.5366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G238900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-18317364148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd+llvd++k+ G g+W++ ++  g++R++k+c++rw +yl
  Sevir.8G238900.1.p 317 KGPWTPEEDKLLVDYIKENGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 364
                         79********************************************97 PP

2Myb_DNA-binding506.9e-16370415148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         r+ +T eE++l++++   lG++ W++Ia +++ gRt++++k++w+++l
  Sevir.8G238900.1.p 370 RDHFTDEEEKLIIHLLSILGNK-WSSIAPKLP-GRTDNEIKNYWYTHL 415
                         6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF078876.5E-37110252IPR012416CALMODULIN-BINDING PROTEIN60
PROSITE profilePS5129425.333312368IPR017930Myb domain
SuperFamilySSF466899.16E-30314411IPR009057Homeodomain-like
SMARTSM007175.0E-15316366IPR001005SANT/Myb domain
PfamPF002498.3E-17317364IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-23318371IPR009057Homeodomain-like
CDDcd001675.70E-11319364No hitNo description
PROSITE profilePS5129420.494369419IPR017930Myb domain
SMARTSM007178.2E-16369417IPR001005SANT/Myb domain
PfamPF002494.2E-14370415IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-24372419IPR009057Homeodomain-like
CDDcd001671.20E-11373415No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006950Biological Processresponse to stress
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MGNAHVLIHT TDKRFTTNPT TLAVQLVWDR PNVELSKRHW NLLDQLMPLP KFNNCGLPTT  60
RLMQEHLDSL TIISKEVMQI RRNRGVIIEP LEPDDSDEER QLKRKMRSKY KLRFVNKVCG  120
AYHTRDPIKA DDGSPLKVAL FDENNIKITY GPLSSASVQI VVLHGDFNDH GQDYWTSEEF  180
SRYEVCPRSG EVVLGGNCIL VLADGEACLG DAFFQMTSYC ARTAKFKMGI RLASAQEERI  240
QEGVSEQFWV KYRHFAGKAL VDNDYQEQNN PMPNLPYRSQ INAGNRLDII WGRSQLPFPG  300
SNMLSTEPST SDASVKKGPW TPEEDKLLVD YIKENGHGSW RRLPKLAGLN RCGKSCRLRW  360
TNYLRPDIKR DHFTDEEEKL IIHLLSILGN KWSSIAPKLP GRTDNEIKNY WYTHLRKKLL  420
SRGIDPVTHR PPNLLAGIPN LLAAGIPNLA AAAQTTWDIS TPCGEKTPAS SPFEGLGNLN  480
LDDEFNSDSS CRDLLEQMSW LNNPNEQQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-253174197108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-114KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979956.11e-176PREDICTED: uncharacterized protein LOC101785879 isoform X4
TrEMBLK3ZPU81e-155K3ZPU8_SETIT; Uncharacterized protein
STRINGSi028628m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1537446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-62myb domain protein 9